feldberg mecklenburg restaurant

"context" : "", ] ] { }, LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); "parameters" : { o.innerHTML = "Page must be in a numeric format. } "actions" : [ { "context" : "envParam:quiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_53","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswer", ] })(LITHIUM.jQuery); "message" : "744559", ] { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "addClassName" "truncateBodyRetainsHtml" : "false", ], // console.log(key); "event" : "RevokeSolutionAction", } "disableKudosForAnonUser" : "false", "event" : "removeThreadUserEmailSubscription", "action" : "rerender" ], } "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetMessageEdit", { }); }, "entity" : "777522", "action" : "rerender" "context" : "", "displaySubject" : "true", ] { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivAndereVFServices/thread-id/19822","ajaxErrorEventName":"LITHIUM:ajaxError","token":"fm8q5WtyRluip1Fns_JtF8SuSw3wu4LbZYZ4ikLWhPI. setWarning(pagerId); "actions" : [ } } } ] { "event" : "approveMessage", ] { { ', 'ajax'); { }, }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", element.removeClass('active'); "event" : "QuickReply", setWarning(pagerId); "event" : "removeMessageUserEmailSubscription", Bist du sicher, dass du fortfahren möchtest? LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; ] "event" : "AcceptSolutionAction", "initiatorBinding" : true, "context" : "", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }, "actions" : [ "useSimpleView" : "false", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/114580","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qLsXsPIR7Val4CATnNlobPH45Jdzfws0DmUEsZPgKCg. "action" : "pulsate" "componentId" : "kudos.widget.button", "entity" : "847259", } }); "useSimpleView" : "false", }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.ComponentEvents.set({ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" } lithstudio: [], "displaySubject" : "true", "context" : "", "event" : "ProductMessageEdit", }, "parameters" : { }, })(LITHIUM.jQuery); if (doChecks(pagerId, val)) }, { "context" : "envParam:feedbackData", "action" : "rerender" "event" : "kudoEntity", "componentId" : "kudos.widget.button", } } "action" : "rerender" ] "context" : "lia-deleted-state", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/114580","ajaxErrorEventName":"LITHIUM:ajaxError","token":"AwmufprcKZ7JFMfGq2jrfXhv-YrM2-oQQKEAoJ_D-YQ. { ] { count = 0; }, "}); }, "initiatorDataMatcher" : "data-lia-kudos-id" }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { LITHIUM.AjaxSupport.ComponentEvents.set({ }, "disableLabelLinks" : "false", "actions" : [ { "actions" : [ ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "}); { "initiatorBinding" : true, "useSubjectIcons" : "true", } }, "action" : "pulsate" jedes Mal bekomme ich nur die  Nachricht: der Wechsel von Tarifoptionen ist zur Zeit aus technischen Günden leider nicht möglich. "actions" : [ LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); "selector" : "#kudosButtonV2_9", "forceSearchRequestParameterForBlurbBuilder" : "false", } "action" : "rerender" { "useSimpleView" : "false", } "event" : "MessagesWidgetMessageEdit", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234302}); { "parameters" : { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "actions" : [ ] { "action" : "rerender" "action" : "rerender" var watching = false; "event" : "editProductMessage", }, }, { { ], $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); }, ] { }, { "; }, Bist du sicher, dass du fortfahren möchtest? { }, count = 0; { function setWarning(pagerId) { { "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" { } { "actions" : [ ], "action" : "rerender" }, "actions" : [ "actions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message", $(document).ready(function(){ "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetEditCommentForm", ] { { { } }, "initiatorDataMatcher" : "data-lia-message-uid" "event" : "unapproveMessage", "action" : "rerender" ', 'ajax'); { { { "actions" : [ } "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", "action" : "rerender" { }; "actions" : [ "event" : "markAsSpamWithoutRedirect", }, } { "parameters" : { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", ] "action" : "rerender" "event" : "kudoEntity", ] LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); nonretriableerror.INVALID_REDIRECT_URI. ] ] "actions" : [ ] var resetMenu = function() { }, "actions" : [ "context" : "envParam:quiltName", "kudosLinksDisabled" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-847259 .lia-rating-control-passive', '#form_6'); ] }, }, "disableLabelLinks" : "false", }, }, "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. "includeRepliesModerationState" : "false", { count = 0; element.removeClass('active'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "defaultAriaLabel" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:feedbackData", "actions" : [ "event" : "addMessageUserEmailSubscription", { }, "action" : "rerender" "selector" : "#messageview_4", "actions" : [ var clickHandler = function(event) { "event" : "expandMessage", "initiatorDataMatcher" : "data-lia-kudos-id" "useSubjectIcons" : "true", { "actions" : [ "actions" : [ ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); ], "action" : "rerender" "context" : "", } } } }, "context" : "", "action" : "rerender" "event" : "editProductMessage", ] if (val.trim() == "") { "action" : "rerender" } "kudosLinksDisabled" : "false", Du kannst Deinen bestehenden Spotify Premium Account jeden Monat kündigen. { { "parameters" : { "action" : "rerender" { { "action" : "rerender" { "actions" : [ { "action" : "rerender" "context" : "envParam:quiltName", ] }, var watching = false; }, }, }, { "event" : "ProductAnswerComment", ] "includeRepliesModerationState" : "false", { "event" : "MessagesWidgetMessageEdit", { ] { "event" : "addMessageUserEmailSubscription", "action" : "rerender" "event" : "editProductMessage", ] "quiltName" : "ForumMessage", } if (1 != val) "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ } "actions" : [ "useSimpleView" : "false", { "action" : "rerender" "event" : "AcceptSolutionAction", "context" : "", "kudosLinksDisabled" : "false", { { { } } LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetCommentForm", ] ] { element.find('li').removeClass('active'); { "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ } ] "}); } $('section.header-announcement').slideUp(); { })(LITHIUM.jQuery); { "eventActions" : [ ] // just for convenience, you need a login anyways... "actions" : [ { }, "action" : "rerender" $('.lia-button-wrapper-searchForm-action').removeClass('active'); "context" : "envParam:quiltName", "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", // enable redirect to login page when "logmein" is typed into the void =) "context" : "", { }, }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-846384 .lia-rating-control-passive', '#form_5'); } } "context" : "envParam:selectedMessage", }, .attr('aria-expanded','true') } count = 0; "action" : "rerender" "actions" : [ { "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "}); }); "context" : "", { "messageViewOptions" : "1111110111111111111110111110100101001101" ] }, "actions" : [ "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "rerender" "context" : "", "actions" : [ "showCountOnly" : "false", $(document).ready(function(){ .attr('aria-hidden','true') } }, "showCountOnly" : "false", "action" : "rerender" "displayStyle" : "horizontal", } "actions" : [ "disableLabelLinks" : "false", { { }, { LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "context" : "", { ] ] }, { "action" : "pulsate" "context" : "", { "useCountToKudo" : "false", "event" : "AcceptSolutionAction", { "actions" : [ } "actions" : [ { } "action" : "rerender" "action" : "rerender" { "event" : "removeThreadUserEmailSubscription", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "unapproveMessage", { { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "event" : "MessagesWidgetMessageEdit", { "initiatorBinding" : true, } }, var resetMenu = function() { "context" : "", "action" : "rerender" } ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] Benutz dafür unsere kostenfreie Rufnummer: 0800 - 664 70 73. { "message" : "838710", "action" : "addClassName" { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "actions" : [ }, "context" : "", { "useTruncatedSubject" : "true", .attr('aria-expanded','false'); }, count = 0; "actions" : [ }, } "actions" : [ Bist du sicher, dass du fortfahren möchtest? "actions" : [ }, { Execute whatever should happen when entering the right sequence LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", } { ;(function($) { ] "event" : "expandMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); }, "context" : "", { "event" : "removeMessageUserEmailSubscription", } if ( Number(val) < 1 ) "action" : "rerender" { { "action" : "rerender" "action" : "rerender" ] LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ;(function($) { "forceSearchRequestParameterForBlurbBuilder" : "false", { "context" : "lia-deleted-state", "event" : "expandMessage", "action" : "rerender" ] LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "action" : "rerender" } { "actions" : [ } "action" : "rerender" "linkDisabled" : "false" "context" : "envParam:selectedMessage", { }, "eventActions" : [ "initiatorBinding" : true, // Oops, not the right sequence, lets restart from the top. "dialogContentCssClass" : "lia-panel-dialog-content", "action" : "rerender" Hier können Sie den Service und ein vorhandenes Paket abbestellen. { } { "initiatorDataMatcher" : "data-lia-message-uid" }); "disableLinks" : "false", "action" : "rerender" ] { }, "actions" : [ "initiatorBinding" : true, "useTruncatedSubject" : "true", }, ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/114580","ajaxErrorEventName":"LITHIUM:ajaxError","token":"9AQc3MJuBx3x-mkPs6qto4YDhWwawi_hdi9ZzC2AqFc. if(do_scroll == "true"){ }, "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "action" : "pulsate" "action" : "rerender" var clickedDomElement = $(this); "context" : "", "context" : "envParam:quiltName,expandedQuiltName", }, "componentId" : "kudos.widget.button", "selector" : "#messageview_3", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } "useTruncatedSubject" : "true", }, "action" : "rerender" ] ], { } LITHIUM.Dialog.options['793536727'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, { "disableKudosForAnonUser" : "false", "includeRepliesModerationState" : "false", }, "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_9","componentSelector":"#lineardisplaymessageviewwrapper_9","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1428505,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] "action" : "rerender" "closeEvent" : "LITHIUM:lightboxCloseEvent", })(LITHIUM.jQuery); ] }, } { "initiatorDataMatcher" : "data-lia-message-uid" "disallowZeroCount" : "false", }, "componentId" : "kudos.widget.button", { Je nach Paket oder Abo fallen dafür ungefähr 1 bis 10 Euro im Monat an. ] "event" : "RevokeSolutionAction", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning");

Tkkg 216 Verschoben, Erdkrümmung Der Erde Pro Km, Kirchenaustritt Online Kärnten, Holy Taco Hamburg Speisekarte, Bin Ich Schwanger Test Quiz, Business English Email Phrases, Screen Time Standort,